Iright
BRAND / VENDOR: Proteintech

Proteintech, 68496-1-Ig, STT3B Monoclonal antibody

CATALOG NUMBER: 68496-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STT3B (68496-1-Ig) by Proteintech is a Monoclonal antibody targeting STT3B in WB, FC (Intra), ELISA applications with reactivity to human samples 68496-1-Ig targets STT3B in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information STT3B is a component of the N-oligosaccharyl transferase (OST) enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3B seems to be involved in complex substrate specificity Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30866 Product name: Recombinant human STT3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 173-225 aa of BC015880 Sequence: APDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKIFKKTV Predict reactive species Full Name: STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae) Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC015880 Gene Symbol: STT3B Gene ID (NCBI): 201595 RRID: AB_3085207 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8TCJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924