Iright
BRAND / VENDOR: Proteintech

Proteintech, 68497-1-Ig, BMPR2 Monoclonal antibody

CATALOG NUMBER: 68497-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BMPR2 (68497-1-Ig) by Proteintech is a Monoclonal antibody targeting BMPR2 in WB, ELISA applications with reactivity to human, mouse samples 68497-1-Ig targets BMPR2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. The dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form, and 150 kD dimer. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5868 Product name: Recombinant human BMPR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 172-504 aa of BC052985 Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL Predict reactive species Full Name: bone morphogenetic protein receptor, type II (serine/threonine kinase) Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 120-140 kDa GenBank Accession Number: BC052985 Gene Symbol: BMPR2 Gene ID (NCBI): 659 RRID: AB_3085208 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13873 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924