Proteintech, 68500-1-Ig, PSPH Monoclonal antibody

Size: 20ul / 150ul The PSPH (68500-1-Ig) by Proteintech is a Monoclonal antibody targeting PSPH in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 68500-1-Ig targets PSPH in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, A375 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IP detected in: HL-60 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSPH (phosphoserine phosphatase) is an enzyme, which is involved in the process of L-serine biosynthesis. PSPH mainly plays role in multiple aspects of cell behaviours such as proliferation and differentiation by producing precursors for the biosynthesis of diverse compounds including neurotransmitters, glycolipids and thymidine (PMID: 11237721, PMID: 19963421). Additionally, augmented PSPH level is correlated with the prognosis in multiple cancers including cutaneous squamous cell carcinoma (PMID: 21726982), breast cancer (PMID: 28931725), non-small cell lung cancer (PMID: 30662358), colorectal cancer (PMID: 24146633) and hepatocellular carcinoma (PMID: 25793315). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6070 Product name: Recombinant human PSPH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC063614 Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE Predict reactive species Full Name: phosphoserine phosphatase Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC063614 Gene Symbol: PSPH Gene ID (NCBI): 5723 RRID: AB_3085211 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P78330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.