Iright
BRAND / VENDOR: Proteintech

Proteintech, 68501-1-Ig, METTL1 Monoclonal antibody

CATALOG NUMBER: 68501-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The METTL1 (68501-1-Ig) by Proteintech is a Monoclonal antibody targeting METTL1 in WB, ELISA applications with reactivity to Human, mouse, pig samples 68501-1-Ig targets METTL1 in WB, ELISA applications and shows reactivity with Human, mouse, pig samples. Tested Applications Positive WB detected in: LNCaP cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation. Specification Tested Reactivity: Human, mouse, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7055 Product name: Recombinant human METTL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species Full Name: methyltransferase like 1 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC000550 Gene Symbol: METTL1 Gene ID (NCBI): 4234 RRID: AB_3085212 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924