Proteintech, 68502-1-Ig, Beta Arrestin 2 Monoclonal antibody

Size: 20ul / 150ul The Beta Arrestin 2 (68502-1-Ig) by Proteintech is a Monoclonal antibody targeting Beta Arrestin 2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 68502-1-Ig targets Beta Arrestin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HeLa cells, MCF-7 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Beta Arrestin 2 is a member of arrestin/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29807 Product name: Recombinant human Beta Arrestin 2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 163-409 aa of BC007427 Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Predict reactive species Full Name: arrestin, beta 2 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC007427 Gene Symbol: Beta Arrestin 2 Gene ID (NCBI): 409 RRID: AB_3085213 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P32121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.