Iright
BRAND / VENDOR: Proteintech

Proteintech, 68507-1-Ig, TEX264 Monoclonal antibody

CATALOG NUMBER: 68507-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TEX264 (68507-1-Ig) by Proteintech is a Monoclonal antibody targeting TEX264 in WB, ELISA applications with reactivity to human samples 68507-1-Ig targets TEX264 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information TEX264 (testes expressed gene 264) is a single-pass transmembrane protein, consisting of an N-terminal hydrophobic region, a gyrase inhibitory (GyrI)-like domain, and a loosely structured C terminus. TEX264 was first identified as an endoplasmic reticulum (ER)-resident Atg8-family-binding protein that mediates the degradation of portions of the ER during starvation (i.e., reticulophagy). TEX264 was identified as a cofactor of VCP/p97 ATPase that promotes the repair of covalently trapped TOP1 (DNA topoisomerase 1)-DNA crosslinks. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33710 Product name: Recombinant human TEX264 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-313 aa of BC008742 Sequence: VEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE Predict reactive species Full Name: testis expressed 264 Calculated Molecular Weight: 313 aa, 34 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC008742 Gene Symbol: TEX264 Gene ID (NCBI): 51368 RRID: AB_3085217 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y6I9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924