Proteintech, 68514-1-Ig, CDK5 Monoclonal antibody

Size: 20ul / 150ul The CDK5 (68514-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 68514-1-Ig targets CDK5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, Caki-1 cells, LNCaP cells, SK-N-SH cells, Jurkat cells, Ramos cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28465 Product name: Recombinant human CDK5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-273 aa of BC005115 Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ Predict reactive species Full Name: cyclin-dependent kinase 5 Calculated Molecular Weight: 31 kDa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC005115 Gene Symbol: CDK5 Gene ID (NCBI): 1020 RRID: AB_3085223 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q00535 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.