Proteintech, 68522-1-Ig, STK24 Monoclonal antibody

Size: 20ul / 150ul The STK24 (68522-1-Ig) by Proteintech is a Monoclonal antibody targeting STK24 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 68522-1-Ig targets STK24 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Serine/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31526 Product name: Recombinant human STK24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 320-443 aa of NM_003576 Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH Predict reactive species Full Name: serine/threonine kinase 24 (STE20 homolog, yeast) Calculated Molecular Weight: 49KD Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_003576 Gene Symbol: STK24 Gene ID (NCBI): 8428 RRID: AB_3085231 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y6E0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.