Proteintech, 68534-1-Ig, PRMT5 Monoclonal antibody

Size: 20ul / 150ul The PRMT5 (68534-1-Ig) by Proteintech is a Monoclonal antibody targeting PRMT5 in WB, ELISA applications with reactivity to Human, rat samples 68534-1-Ig targets PRMT5 in WB, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PRMT5 is a Type II enzyme that catalyzes arginine monomethylation and symmetric dimethylation (Rme1 and Rme2s). The many targets of PRMT5 include ribosomal proteins, the histone chaperone nucleoplasmin, p53, and histones. PRMT5 is frequently observed in a complex with the cofactor, methylosome protein 50 (MEP50), which is required for PRMT5 activity. PRMT5 is upregulated in several human malignancies, including lymphomas, lung cancer, breast cancer and colorectal cancer. Specification Tested Reactivity: Human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9678 Product name: Recombinant human PRMT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-637 aa of BC025979 Sequence: YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL Predict reactive species Full Name: protein arginine methyltransferase 5 Calculated Molecular Weight: 637 aa, 73 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC025979 Gene Symbol: PRMT5 Gene ID (NCBI): 10419 RRID: AB_3085242 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14744 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.