Iright
BRAND / VENDOR: Proteintech

Proteintech, 68546-1-Ig, RPAIN Monoclonal antibody

CATALOG NUMBER: 68546-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RPAIN (68546-1-Ig) by Proteintech is a Monoclonal antibody targeting RPAIN in WB, ELISA applications with reactivity to human samples 68546-1-Ig targets RPAIN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, A2780 cells, LNCap cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Replication protein A (RPA) is a eukaryotic single-stranded DNA binding protein that is essential for DNA replication, repair, and recombination, and human RPA interacting protein α (hRIPα) is the nuclear transporter of RPA. RPAIN was originally identified as a nuclear transporter of RPA in Xenopus (PMID: 23010595). The human RIPα gene encodes several splice isoforms, of which hRIPα and hRIPβ are the major translation products in vivo.hRIPα transports RPA into the nucleus by shuttling between the cytoplasm and nucleus while hRIPβ is localized in promyelocytic leukemia (PML) nuclear bodies. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7844 Product name: Recombinant human RPAIN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC004451 Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS Predict reactive species Full Name: RPA interacting protein Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC004451 Gene Symbol: RPAIN Gene ID (NCBI): 84268 RRID: AB_3085251 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86UA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924