Iright
BRAND / VENDOR: Proteintech

Proteintech, 68552-1-Ig, RAB35 Monoclonal antibody

CATALOG NUMBER: 68552-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB35 (68552-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB35 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit samples 68552-1-Ig targets RAB35 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors. Specification Tested Reactivity: Human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21424 Product name: Recombinant human RAB35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC015931 Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC Predict reactive species Full Name: RAB35, member RAS oncogene family Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC015931 Gene Symbol: RAB35 Gene ID (NCBI): 11021 RRID: AB_3085256 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15286 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924