Iright
BRAND / VENDOR: Proteintech

Proteintech, 68582-1-Ig, PTPIP51 Monoclonal antibody

CATALOG NUMBER: 68582-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PTPIP51 (68582-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPIP51 in WB, IF/ICC, ELISA applications with reactivity to human samples 68582-1-Ig targets PTPIP51 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HepG2 cells, HuH-7 cells, HT-29 cells, HEK-293 cells, K-562 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:238-1:952 Background Information Protein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618).The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15135 Product name: Recombinant human PTPIP51 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-141 aa of BC008970 Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH Predict reactive species Full Name: family with sequence similarity 82, member A2 Calculated Molecular Weight: 470 aa, 52 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC008970 Gene Symbol: PTPIP51 Gene ID (NCBI): 55177 RRID: AB_3085282 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96TC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924