Proteintech, 68588-1-Ig, IQGAP1 Monoclonal antibody

Size: 20ul / 150ul The IQGAP1 (68588-1-Ig) by Proteintech is a Monoclonal antibody targeting IQGAP1 in WB, IHC, ELISA applications with reactivity to human, rat samples 68588-1-Ig targets IQGAP1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion. Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19321 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species Full Name: IQ motif containing GTPase activating protein 1 Calculated Molecular Weight: 189 kDa Observed Molecular Weight: 190-195 kDa GenBank Accession Number: BC151834 Gene Symbol: IQGAP1 Gene ID (NCBI): 8826 ENSEMBL Gene ID: ENSG00000140575 RRID: AB_3085287 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.