Iright
BRAND / VENDOR: Proteintech

Proteintech, 68607-1-Ig, TCF4 Monoclonal antibody

CATALOG NUMBER: 68607-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TCF4 (68607-1-Ig) by Proteintech is a Monoclonal antibody targeting TCF4 in WB, ELISA applications with reactivity to human, rat samples 68607-1-Ig targets TCF4 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: U2OS cells, HCT 116 cells, Caco-2 cells, A549 cells, PC-12 cells, SH-SY5Y cells, K-562 cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17897 Product name: Recombinant human TCF4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 407-560 aa of BC125084 Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE Predict reactive species Full Name: transcription factor 4 Calculated Molecular Weight: 671 aa, 72 kDa Observed Molecular Weight: 72 kDa; 68 kDa GenBank Accession Number: BC125084 Gene Symbol: TCF4 Gene ID (NCBI): 6925 RRID: AB_3085302 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924