Iright
BRAND / VENDOR: Proteintech

Proteintech, 68611-1-Ig, BCOR Monoclonal antibody

CATALOG NUMBER: 68611-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BCOR (68611-1-Ig) by Proteintech is a Monoclonal antibody targeting BCOR in WB, ELISA applications with reactivity to Human, mouse samples 68611-1-Ig targets BCOR in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, SW480 cells, HEK-293 cells, RAW 264.7 cells, MCF-7 cells, Jurkat cells, MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1/nervous system polycomb1 (PCGF1/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33785 Product name: Recombinant human BCOR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-361 aa of BC009675 Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW Predict reactive species Full Name: BCL6 co-repressor Calculated Molecular Weight: 1703 aa, 186 kDa Observed Molecular Weight: 186-200 kDa GenBank Accession Number: BC009675 Gene Symbol: BCOR Gene ID (NCBI): 54880 RRID: AB_3085306 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6W2J9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924