Proteintech, 68613-1-Ig, KANK1 Monoclonal antibody

Size: 20ul / 150ul The KANK1 (68613-1-Ig) by Proteintech is a Monoclonal antibody targeting KANK1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 68613-1-Ig targets KANK1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, PC-3 cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, HuH-7 cells, Daudi cells, Raji cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information KANK1 (KN motif and ankyrin repeat domain-containing protein 1) is involved in the control of cytoskeleton formation by regulating actin polymerization, inhibiting actin fiber formation and cell migration (PMID: 25961457). It inhibits RhoA activity, the formation of lamellipodia but not of filopodia (PMID: 25961457, PMID: 5961457).It also inhibits fibronectin-mediated cell spreading and regulates Rac signaling pathways (PMID: 25961457). Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions (PMID: 27410476). KANK1 can be detected 130-200 kDa (PMID: 15823577, PMID: 33253712, PMID: 35805114). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31440 Product name: Recombinant human KANK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-467 aa of NM_015158 Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE Predict reactive species Full Name: KN motif and ankyrin repeat domains 1 Calculated Molecular Weight: 147KD Observed Molecular Weight: 130-200 kDa GenBank Accession Number: NM_015158 Gene Symbol: KANK1 Gene ID (NCBI): 23189 RRID: AB_3085307 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.