Proteintech, 68620-1-Ig, PRKCB Monoclonal antibody

Size: 20ul / 150ul The PRKCB (68620-1-Ig) by Proteintech is a Monoclonal antibody targeting PRKCB in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68620-1-Ig targets PRKCB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: human brain tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. Protein kinase Cs (PKCs) are signaling molecules that play key roles in many cellular processes, including secretion, gene expression, proliferation, and muscle contraction. The PKC family is broadly divided into three subgroups: classical, novel, and atypical PKCs. These subgroups differ in both protein sequences and mechanistic requirements for catalytic activity. PKC beta is one of the PKC family members. PKC beta has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33693 Product name: Recombinant human PRKCB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 342-598 aa of BC036472 Sequence: FNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHA Predict reactive species Full Name: protein kinase C, beta Calculated Molecular Weight: 673 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC036472 Gene Symbol: PRKCB Gene ID (NCBI): 5579 RRID: AB_3085312 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.