Proteintech, 68622-1-Ig, UCK2 Monoclonal antibody

Size: 20ul / 150ul The UCK2 (68622-1-Ig) by Proteintech is a Monoclonal antibody targeting UCK2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68622-1-Ig targets UCK2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Uridine-cytidine kinase 2 catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. UCK2 belongs to the uridine kinase family and UCK have important roles for the phosphorylation of nucleoside analogs that may be important in chemotherapy of cancer. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0782 Product name: Recombinant human UCK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-261 aa of BC002906 Sequence: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH Predict reactive species Full Name: uridine-cytidine kinase 2 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: ~30 kDa GenBank Accession Number: BC002906 Gene Symbol: UCK2 Gene ID (NCBI): 7371 RRID: AB_3085314 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BZX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.