Proteintech, 68626-1-Ig, PPM1F Monoclonal antibody

Size: 20ul / 150ul The PPM1F (68626-1-Ig) by Proteintech is a Monoclonal antibody targeting PPM1F in WB, ELISA applications with reactivity to Human samples 68626-1-Ig targets PPM1F in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U2OS cells, A375 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Mg2+/Mn2+-dependent protein phosphatase 1F (PPM1F) belongs to the PP2C family of Ser/Thr protein phosphatases and is the critical enzyme responsible for dephosphorylating the threonine motif. PPM1F is ubiquitous in various tissues and organs (PMID: 26498692). High expression of PPM1F was positively associated with poor survival and tumor recurrence in patients with cancers and PPM1F might be a potential biomarker in HCC patients (PMID: 30470261). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10316 Product name: Recombinant human PPM1F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-453 aa of BC071989 Sequence: EEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS Predict reactive species Full Name: protein phosphatase 1F (PP2C domain containing) Calculated Molecular Weight: 453 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC071989 Gene Symbol: PPM1F Gene ID (NCBI): 9647 RRID: AB_3085318 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49593 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.