Iright
BRAND / VENDOR: Proteintech

Proteintech, 68631-1-Ig, TNNT1 Monoclonal antibody

CATALOG NUMBER: 68631-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TNNT1 (68631-1-Ig) by Proteintech is a Monoclonal antibody targeting TNNT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68631-1-Ig targets TNNT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue Positive IHC detected in: rat skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8919 Product name: Recombinant human TNNT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 46-297 aa of BC022086 Sequence: RMSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK Predict reactive species Full Name: troponin T type 1 (skeletal, slow) Calculated Molecular Weight: 252aa,27 kDa; 192aa,21 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC022086 Gene Symbol: TNNT1 Gene ID (NCBI): 7138 RRID: AB_3085322 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P13805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924