Iright
BRAND / VENDOR: Proteintech

Proteintech, 68633-1-Ig, ST6GAL1 Monoclonal antibody

CATALOG NUMBER: 68633-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ST6GAL1 (68633-1-Ig) by Proteintech is a Monoclonal antibody targeting ST6GAL1 in WB, ELISA applications with reactivity to human, pig samples 68633-1-Ig targets ST6GAL1 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: TF-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with unknown reason. (PMID: 15049997) Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6181 Product name: Recombinant human ST6GAL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 60-406 aa of BC040009 Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC Predict reactive species Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 43-45 kDa, 50-70 kDa GenBank Accession Number: BC040009 Gene Symbol: ST6GAL1 Gene ID (NCBI): 6480 RRID: AB_3085324 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15907 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924