Proteintech, 68640-1-Ig, cGAS Monoclonal antibody

Size: 20ul / 150ul The cGAS (68640-1-Ig) by Proteintech is a Monoclonal antibody targeting cGAS in WB, IF/ICC, ELISA applications with reactivity to human samples 68640-1-Ig targets cGAS in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Karpas-299 cells, MDA-MB-231 cells, NCI-H1299 cells, SCaBER cells, A431 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information cGAS (Cyclic GMP-AMP synthase), also known as C6orf150 or h-cGAS, is a 522 aa protein. cGAS mediates innate immune responses against invading pathogens, or against self-dsDNA, which causes autoimmune disorders. The cGAS sensor not only recognizes cytosolic dsDNA but also synthesizes the second messenger cGAMP from ATP and GTP, which then binds to and activates STING. STING undergoes conformational changes and translocation from the endoplasmic reticulum to the Golgi apparatus to encounter TBK1 and IRF3, eventually triggering the production of type I IFNs. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30074 Product name: Recombinant human C6orf150 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 322-433 aa of BC113608 Sequence: LALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKF Predict reactive species Full Name: chromosome 6 open reading frame 150 Calculated Molecular Weight: 496 aa, 54 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC113608 Gene Symbol: cGAS Gene ID (NCBI): 115004 RRID: AB_3085328 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8N884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.