Proteintech, 68650-1-Ig, FBXO22 Monoclonal antibody

Size: 20ul / 150ul The FBXO22 (68650-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO22 in WB, ELISA applications with reactivity to human samples 68650-1-Ig targets FBXO22 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HEK-293 cells, HepG2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FBXO22, also named as FBX22, is a substrate-recognition of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. FBXO22 is a key regulator of senescence induction through ubiquitylation of p53 for degradation. FBXO22 also acts as a molecular switch for the antagonistic and agonistic actions of selective estrogen receptor modulators (SERM) and determines the sensitivity of breast cancer to SERM by ubiquitylating KDM4B complexed with unliganded or SERMs‐bound estrogen receptor (ER). (PMID: 32536008, PMID: 32249768) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5294 Product name: Recombinant human FBXO22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC039024 Sequence: MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK Predict reactive species Full Name: F-box protein 22 Calculated Molecular Weight: 403 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC039024 Gene Symbol: FBXO22 Gene ID (NCBI): 26263 RRID: AB_3670392 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NEZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.