Iright
BRAND / VENDOR: Proteintech

Proteintech, 68656-1-Ig, RNF7 Monoclonal antibody

CATALOG NUMBER: 68656-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RNF7 (68656-1-Ig) by Proteintech is a Monoclonal antibody targeting RNF7 in WB, ELISA applications with reactivity to Human samples 68656-1-Ig targets RNF7 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, K-562 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16903 Product name: Recombinant human SAG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC008627 Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK Predict reactive species Full Name: ring finger protein 7 Calculated Molecular Weight: 113 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC008627 Gene Symbol: RNF7 Gene ID (NCBI): 9616 RRID: AB_3670398 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UBF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924