Iright
BRAND / VENDOR: Proteintech

Proteintech, 68724-1-Ig, ENPP2 Monoclonal antibody

CATALOG NUMBER: 68724-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ENPP2 (68724-1-Ig) by Proteintech is a Monoclonal antibody targeting ENPP2 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68724-1-Ig targets ENPP2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, HuH-7 cells, U-87 MG cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ENPP2, Autotaxin or Extracellular lysophospholipase D, is a 863 amino acid secreted protein, which is detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). ENPP2 is Predominantly expressed in brain, placenta, ovary, and small intestine. ENPP2 is expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. ENPP2 is expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. The calculated molecular weight of ENPP2 is about 100 kDa (PMID: 22301782), but modified ENPP2 is 120 kDa (PMID: 19808661). ENPP2 Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5499 Product name: Recombinant human ENPP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-383 aa of BC034961 Sequence: AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 2 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC034961 Gene Symbol: ENPP2 Gene ID (NCBI): 5168 RRID: AB_3670416 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13822 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924