Proteintech, 68736-1-Ig, Medin Monoclonal antibody

Size: 20ul / 150ul The Medin (68736-1-Ig) by Proteintech is a Monoclonal antibody targeting Medin in WB, ELISA applications with reactivity to human samples 68736-1-Ig targets Medin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30145 Product name: Recombinant human MFGE8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 268-317 aa of NM_005928 Sequence: RLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVA Predict reactive species Full Name: milk fat globule-EGF factor 8 protein Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: NM_005928 Gene Symbol: MFGE8 Gene ID (NCBI): 4240 RRID: AB_3670421 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q08431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.