Proteintech, 68827-1-Ig, CD69 Monoclonal antibody

Size: 20ul / 150ul The CD69 (68827-1-Ig) by Proteintech is a Monoclonal antibody targeting CD69 in WB, ELISA applications with reactivity to Human samples 68827-1-Ig targets CD69 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U-937 cells, THP-1 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, and several subsets of tissue-resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in regulating immune responses (PMID: 15745855). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30963 Product name: Recombinant human CD69 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-199 aa of BC007037 Sequence: STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Predict reactive species Full Name: CD69 molecule Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC007037 Gene Symbol: CD69 Gene ID (NCBI): 969 RRID: AB_3670438 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q07108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.