Proteintech, 68846-1-Ig, CORO1C Monoclonal antibody

Size: 20ul / 150ul The CORO1C (68846-1-Ig) by Proteintech is a Monoclonal antibody targeting CORO1C in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68846-1-Ig targets CORO1C in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: hTERT-RPE1 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, MDA-MB-231 cells, A549 cells, A431 cells, HepG2 cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6546 Product name: Recombinant human CORO1C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-306 aa of BC002342 Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN Predict reactive species Full Name: coronin, actin binding protein, 1C Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC002342 Gene Symbol: CORO1C Gene ID (NCBI): 23603 RRID: AB_3670439 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ULV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.