Iright
BRAND / VENDOR: Proteintech

Proteintech, 68871-4-Ig, SPHK2 Monoclonal antibody

CATALOG NUMBER: 68871-4-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPHK2 (68871-4-Ig) by Proteintech is a Monoclonal antibody targeting SPHK2 in WB, ELISA applications with reactivity to human, mouse, rat samples 68871-4-Ig targets SPHK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HT-29 cells, Caco-2 cells, Jurkat cells, MOLT-4 cells, MJ cells, J774A.1 cells, Rat brain tissue, Mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10569 Product name: Recombinant human SPHK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-618 aa of BC010671 Sequence: LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP Predict reactive species Full Name: sphingosine kinase 2 Calculated Molecular Weight: 618 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC010671 Gene Symbol: SPHK2 Gene ID (NCBI): 56848 RRID: AB_3670443 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924