Iright
BRAND / VENDOR: Proteintech

Proteintech, 68877-1-Ig, ADCK4 Monoclonal antibody

CATALOG NUMBER: 68877-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ADCK4 (68877-1-Ig) by Proteintech is a Monoclonal antibody targeting ADCK4 in WB, ELISA applications with reactivity to human samples 68877-1-Ig targets ADCK4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ADCK4 (AarF domain-containing protein kinase 4), also known as COQ8B (Coenzyme Q protein 8B), is an atypical kinase involved in the biosynthesis of coenzyme Q, which is also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PMID: 24270420). Its substrate specificity is unclear: does not show any protein kinase activity. It probably acts as a small molecule kinase, possibly a lipid kinase that phosphorylates a prenyl lipid in the ubiquinone biosynthesis pathway (PMID: 24270420). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13188 Product name: Recombinant human ADCK4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 195-544 aa of BC013114 Sequence: LEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS Predict reactive species Full Name: aarF domain containing kinase 4 Calculated Molecular Weight: 544 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC013114 Gene Symbol: ADCK4 Gene ID (NCBI): 79934 RRID: AB_3670444 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96D53 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924