Proteintech, 68900-1-Ig, S100A9 Monoclonal antibody

Size: 20ul / 150ul The S100A9 (68900-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A9 in WB, IF/ICC, ELISA applications with reactivity to human samples 68900-1-Ig targets S100A9 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva, HT-1376 cells, MDA-MB-468 cells, SK-BR-3 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27025 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species Full Name: S100 calcium binding protein A9 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC047681 Gene Symbol: S100A9 Gene ID (NCBI): 6280 RRID: AB_3670450 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P06702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.