Proteintech, 68924-1-Ig, ARF6 Monoclonal antibody

Size: 20ul / 150ul The ARF6 (68924-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF6 in WB, ELISA applications with reactivity to human, pig samples 68924-1-Ig targets ARF6 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, MCF-7 cells, pig liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF6 is one of best identified ARFs It is present at the plasma membrane and to some extent on endosomal membranes where it regulates the flow of trafficking into and out of the cell and the actin cytoskeleton. The antibody is specific to ARF6. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12642 Product name: Recombinant human ARF6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 37-152 aa of BC002952 Sequence: SVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQP Predict reactive species Full Name: ADP-ribosylation factor 6 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC002952 Gene Symbol: ARF6 Gene ID (NCBI): 382 RRID: AB_3670454 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P62330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.