Proteintech, 80017-1-RR, calreticulin Recombinant monoclonal antibody

Size: 20ul / 100ul The calreticulin (80017-1-RR) by Proteintech is a Recombinant antibody targeting calreticulin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 80017-1-RR targets calreticulin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, HSC-T6 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: human thyroid cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26064 Product name: Recombinant human calreticulin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-417 aa of BC002500 Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL Predict reactive species Full Name: calreticulin Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC002500 Gene Symbol: Calreticulin Gene ID (NCBI): 811 RRID: AB_2882941 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.