Proteintech, 80046-5-RR, HSP27 Recombinant monoclonal antibody

Size: 20ul / 100ul The HSP27 (80046-5-RR) by Proteintech is a Recombinant antibody targeting HSP27 in WB, IF/ICC, ELISA applications with reactivity to human samples 80046-5-RR targets HSP27 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4620 Product name: Recombinant Human HSP27 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 70-184 aa of NM_001540.5 Sequence: APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVT Predict reactive species Full Name: heat shock 27kDa protein 1 Calculated Molecular Weight: 23kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: NM_001540.5 Gene Symbol: HSPB1 Gene ID (NCBI): 3315 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04792 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.