Iright
BRAND / VENDOR: Proteintech

Proteintech, 80152-1-RR, TMPRSS2 Recombinant monoclonal antibody

CATALOG NUMBER: 80152-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TMPRSS2 (80152-1-RR) by Proteintech is a Recombinant antibody targeting TMPRSS2 in WB, ELISA applications with reactivity to Human samples 80152-1-RR targets TMPRSS2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: PC-3 cells, LNCaP cells, Caco-2 cells, COLO 320 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information TMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumor metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 as a host cell factor that is critical for spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5824 Product name: Recombinant human TMPRSS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-492 aa of BC051839 Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Predict reactive species Full Name: transmembrane protease, serine 2 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC051839 Gene Symbol: TMPRSS2 Gene ID (NCBI): 7113 RRID: AB_2935544 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15393 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924