Proteintech, 80165-1-RR, TMEM173/STING Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM173/STING (80165-1-RR) by Proteintech is a Recombinant antibody targeting TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human samples 80165-1-RR targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MOLT-4 cells, Jurkat cells, K-562 cells, THP-1 cells, HSC-T6 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human tonsillitis tissue, human colon tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF-Fro detected in: mouse cerebellum tissue Positive IF/ICC detected in: THP-1 cells, human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species Full Name: transmembrane protein 173 Calculated Molecular Weight: 379 aa, 42 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC047779 Gene Symbol: STING Gene ID (NCBI): 340061 RRID: AB_2918870 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86WV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.