Proteintech, 80210-13-RR, Nanog Recombinant monoclonal antibody

Size: 20ul / 100ul The Nanog (80210-13-RR) by Proteintech is a Recombinant antibody targeting Nanog in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 80210-13-RR targets Nanog in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse brain tissue, rat brain tissue, C2C12 cells Positive IHC detected in: mouse brain tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NCCIT cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. There are two kinds of variants that can be recognized by NANOG, one is a normal form (~39 kDa), the other is a post-translation modified form (~48 kDa) (21136380 ). Nanog has two isoforms with molecular weights of 34.4 kDa and 31.9 kDa. (PMID: 21969378) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5645 Product name: Recombinant human NANOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC160187 Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Predict reactive species Full Name: Nanog homeobox Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC160187 Gene Symbol: Nanog Gene ID (NCBI): 79923 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9S0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.