Proteintech, 80545-1-RR, Occludin Recombinant monoclonal antibody

Size: 20ul / 100ul The Occludin (80545-1-RR) by Proteintech is a Recombinant antibody targeting Occludin in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, pig samples 80545-1-RR targets Occludin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HaCaT cells, pig colon tissue, mouse colon tissue, HUVEC cells, U2OS cells Positive IP detected in: HUVEC cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels. The monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074). Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species Full Name: occludin Calculated Molecular Weight: 522 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC029886 Gene Symbol: Occludin Gene ID (NCBI): 4950 RRID: AB_2918901 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.