Proteintech, 80713-1-RR, Beta Tubulin Recombinant monoclonal antibody

Size: 100ul The Beta Tubulin (80713-1-RR) by Proteintech is a Recombinant antibody targeting Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, zebrafish samples 80713-1-RR targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, zebrafish tissue, Jurkat cells, K-562 cells, Hsc-T6 cells, NIH/3T3 cells, mouse brain, rat brain Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF/ICC detected in: C2C12 cells, HeLa cells, HepG2 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs. Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0117 Product name: Recombinant human Tubulin-beta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-259 aa of BC000748 Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP Predict reactive species Full Name: tubulin, beta 3 Calculated Molecular Weight: 450 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000748 Gene Symbol: TUBB3 Gene ID (NCBI): 10381 RRID: AB_2918906 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13509 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.