Proteintech, 80979-1-RR, NF-κB p65 Recombinant monoclonal antibody

Size: 20ul / 100ul The NF-κB p65 (80979-1-RR) by Proteintech is a Recombinant antibody targeting NF-κB p65 in WB, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 80979-1-RR targets NF-κB p65 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, MOLT-4 cells, Jurkat cells, Raji cells, NIH/3T3 cells, HSC-T6 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells, TNF alpha treated HT-1080 cells Positive FC (Intra) detected in: HepG2 cells Positive ChIP-qPCR detected in: hTNF-α-HeLa, 30 ng/ml, 1 h HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:40000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Nuclear factor kB (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit monoclonal antibody raised against residues near the N terminus of human RELA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species Full Name: v-rel reticuloendotheliosis viral oncogene homolog A (avian) Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC011603 Gene Symbol: NF-κB p65 Gene ID (NCBI): 5970 RRID: AB_2918923 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.