Proteintech, 80992-1-RR, ubiquitin Recombinant monoclonal antibody

Size: 20ul / 100ul The ubiquitin (80992-1-RR) by Proteintech is a Recombinant antibody targeting ubiquitin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, canine, hamster, yeast, spinach samples 80992-1-RR targets ubiquitin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine, hamster, yeast, spinach samples. Tested Applications Positive WB detected in: NIH/3T3 cells, MG132 treated NIH/3T3 cells Positive IHC detected in: human pancreas cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:10000-1:100000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Ubiquitin B (UBB) is a member of ubiquitin family, one of the most conserved proteins known. Ubiquitin B is required for ATP-dependent, non-lysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin B is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression.When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome. Interestingly ubiquitin also becomes covalently bonded to many types of pathological inclusions which appear to be resistant to normal degradation. Specification Tested Reactivity: human, mouse, rat, canine, hamster, yeast, spinach Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0260 Product name: Recombinant human ubiquitin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-229 aa of BC000379 Sequence: KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC Predict reactive species Full Name: ubiquitin B GenBank Accession Number: BC000379 Gene Symbol: ubiquitin Gene ID (NCBI): 7314 RRID: AB_2923694 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P0CG47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.