Proteintech, 81017-1-RR, S100A10 Recombinant monoclonal antibody

Size: 20ul / 100ul The S100A10 (81017-1-RR) by Proteintech is a Recombinant antibody targeting S100A10 in WB, IHC, ELISA applications with reactivity to human, mouse samples 81017-1-RR targets S100A10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, U2OS cells, HaCaT cells, human lung tissue Positive IHC detected in: human colon tissue, mouse skin tissue, human pancreas cancer tissue, human lung cancer tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis. Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1779 Product name: Recombinant human S100A10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species Full Name: S100 calcium binding protein A10 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC015973 Gene Symbol: S100A10 Gene ID (NCBI): 6281 RRID: AB_2918925 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60903 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.