Product Description
Size: 20ul / 100ul
The FGFR4 (81069-1-RR) by Proteintech is a Recombinant antibody targeting FGFR4 in WB, IHC, ELISA applications with reactivity to human samples
81069-1-RR targets FGFR4 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MOLT-4 cells, HepG2 cells, Raji cells, Jurkat cells, HeLa cells, HT-29 cells, A549 cells
Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag31013 Product name: Recombinant human FGFR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 742-802 aa of BC011847 Sequence: ALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT Predict reactive species
Full Name: fibroblast growth factor receptor 4
Calculated Molecular Weight: 88 kDa
Observed Molecular Weight: 100-110 kDa
GenBank Accession Number: BC011847
Gene Symbol: FGFR4
Gene ID (NCBI): 2264
RRID: AB_2918926
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P22455
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924