Iright
BRAND / VENDOR: Proteintech

Proteintech, 81069-1-RR, FGFR4 Recombinant monoclonal antibody

CATALOG NUMBER: 81069-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FGFR4 (81069-1-RR) by Proteintech is a Recombinant antibody targeting FGFR4 in WB, IHC, ELISA applications with reactivity to human samples 81069-1-RR targets FGFR4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells, HepG2 cells, Raji cells, Jurkat cells, HeLa cells, HT-29 cells, A549 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31013 Product name: Recombinant human FGFR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 742-802 aa of BC011847 Sequence: ALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT Predict reactive species Full Name: fibroblast growth factor receptor 4 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC011847 Gene Symbol: FGFR4 Gene ID (NCBI): 2264 RRID: AB_2918926 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22455 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924