Iright
BRAND / VENDOR: Proteintech

Proteintech, 81119-1-RR, Beta Actin Recombinant monoclonal antibody

CATALOG NUMBER: 81119-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ul The Beta Actin (81119-1-RR) by Proteintech is a Recombinant antibody targeting Beta Actin in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 81119-1-RR targets Beta Actin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Beta Actin, a 42-kDa protein encoded by the ACTB gene, is a highly conserved, ubiquitous protein that forms microfilaments, making it a major component of the cell's cytoskeleton and contractile apparatus. It plays essential roles in cell structure, growth, motility, and intracellular transport, and it's also involved in gene expression regulation by associating with chromatin remodeling complexes. Due to its stable and constitutive expression across different tissues and under most experimental conditions, beta-actin is extensively utilized as an internal loading control in molecular biology techniques, including Western blotting, quantitative PCR (qPCR), and immunohistochemistry, for normalizing gene and protein expression data. Based on epitope identification, this antibody specifically recognizes ACTB and does not exhibit cross-reactivity with ACTA1/ACTA2. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species Full Name: actin, beta Calculated Molecular Weight: 375 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC002409 Gene Symbol: Beta Actin Gene ID (NCBI): 60 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924