Product Description
Size: 20ul / 100ul
The IDH1 (81176-1-RR) by Proteintech is a Recombinant antibody targeting IDH1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples
81176-1-RR targets IDH1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, mouse liver tissue, rat liver tissue
Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive FC (Intra) detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species
Full Name: isocitrate dehydrogenase 1 (NADP+), soluble
Calculated Molecular Weight: 414 aa, 47 kDa
Observed Molecular Weight: 46 kDa
GenBank Accession Number: BC012846
Gene Symbol: IDH1
Gene ID (NCBI): 3417
RRID: AB_2923706
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O75874
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924