Iright
BRAND / VENDOR: Proteintech

Proteintech, 81176-1-RR, IDH1 Recombinant monoclonal antibody

CATALOG NUMBER: 81176-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The IDH1 (81176-1-RR) by Proteintech is a Recombinant antibody targeting IDH1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 81176-1-RR targets IDH1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species Full Name: isocitrate dehydrogenase 1 (NADP+), soluble Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC012846 Gene Symbol: IDH1 Gene ID (NCBI): 3417 RRID: AB_2923706 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924