Proteintech, 81245-1-RR, EEA1 Recombinant monoclonal antibody

Size: 20ul / 100ul The EEA1 (81245-1-RR) by Proteintech is a Recombinant antibody targeting EEA1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 81245-1-RR targets EEA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, HeLa cells, LNCaP cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28814 Product name: Recombinant human EEA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1151-1350 aa of NM_003566 Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA Predict reactive species Full Name: early endosome antigen 1 Calculated Molecular Weight: 162 kDa Observed Molecular Weight: 162 kDa GenBank Accession Number: NM_003566 Gene Symbol: EEA1 Gene ID (NCBI): 8411 RRID: AB_2923711 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15075 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.