Proteintech, 81323-2-RR, VEGFA Recombinant monoclonal antibody

Size: 20ul / 100ul The VEGFA (81323-2-RR) by Proteintech is a Recombinant antibody targeting VEGFA in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 81323-2-RR targets VEGFA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells, A431 cells, MDA-MB-231 cells, HUVEC cells, RAW 264.7 cells Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13500 Product name: Recombinant human VEGFA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR Predict reactive species Full Name: vascular endothelial growth factor A Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC065522 Gene Symbol: VEGFA Gene ID (NCBI): 7422 RRID: AB_3086457 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15692 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.