Iright
BRAND / VENDOR: Proteintech

Proteintech, 81462-1-RR, CHOP/GADD153 Recombinant monoclonal antibody

CATALOG NUMBER: 81462-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CHOP/GADD153 (81462-1-RR) by Proteintech is a Recombinant antibody targeting CHOP/GADD153 in WB, ELISA, ChIP-qPCR applications with reactivity to human, mouse samples 81462-1-RR targets CHOP/GADD153 in WB, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Tunicamycin treated HeLa cells, Tunicamycin treated Jurkat cells Positive ChIP-qPCR detected in: Tunicamycin (2ug/ml, overnigh) NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species Full Name: DNA-damage-inducible transcript 3 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003637 Gene Symbol: CHOP Gene ID (NCBI): 1649 RRID: AB_2935550 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924