Proteintech, 81471-1-RR, FTO Recombinant monoclonal antibody

Size: 20ul / 100ul The FTO (81471-1-RR) by Proteintech is a Recombinant antibody targeting FTO in WB, IF/ICC, ELISA applications with reactivity to human samples 81471-1-RR targets FTO in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, HEK-293T cells, LNCaP cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in th1e FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species Full Name: fat mass and obesity associated Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_001080432 Gene Symbol: FTO Gene ID (NCBI): 79068 RRID: AB_2935551 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9C0B1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.