Proteintech, 81667-5-RR, JUN Recombinant monoclonal antibody

Size: 20ul / 100ul The JUN (81667-5-RR) by Proteintech is a Recombinant antibody targeting JUN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 81667-5-RR targets JUN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: UV treated HeLa cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis (PMID: 22180088). JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription (PMID: 9732876). In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression (PMID:8464713). More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins (PMID: 15469925). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17304 Product name: Recombinant human JUN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-227 aa of BC068522 Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE Predict reactive species Full Name: jun oncogene Calculated Molecular Weight: 331 aa, 36 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC068522 Gene Symbol: JUN Gene ID (NCBI): 3725 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05412 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.